![[Home Page]](/images/icons/gramene_logo180new.jpg "[Home Page]"){kind=icon}
Protein Home |
Advanced Search |
Search by Pfam or PROSITE |
Browse by GO Slim |
Documents |
Tutorial |
FAQ |
Help
Oryza sativa (japonica cultivar-group) protein "Q94DF2" (Putative serine/threonine-specific protein kinase) | Accession | Q94DF2 |
|---|---|
| Species | Oryza sativa (japonica cultivar-group) [ GR_tax:013684 ] |
| Name | Putative serine/threonine-specific protein kinase |
| Symbol | P0518C01.36 |
| Synonyms (0) | |
| E.C. Numbers (0) | None |
| Gene Names (1) | P0518C01.36 |
| Organelle | Not available |
| Best Hits To TIGR Rice Gene Models (0) | None |
| IRGSP/RAP Genes (0) | None |
| Source | TREMBL |
| GenBank Accessions (1) | BAB63697 |
| UniProt Accession (Sequence) | Q94DF2 |
| Cultivar | Nipponbare ( GRIN , IRIS ) |
Associated Ontologies (3) | Term Type | Term | Reference | Evidence | |||
|---|---|---|---|---|---|---|
| Molecular Function | ATP binding (GO:0005524) | Jaiswal-P et al., 2003 |
| |||
| protein serine/threonine kinase activity (GO:0004674) | Jaiswal-P et al., 2003 |
| ||||
| Jaiswal-P et al., 2002 | ISS | |||||
| Biological Process | protein phosphorylation (GO:0006468) | Jaiswal-P et al., 2003 |
|
Keywords (3) Similarity to Other Proteins (22) | Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
| Others : Fungi | Metazoa |
| 3D protein structures : BLink from NCBI |
Protein Features (6) | Pfam (Info) | PF00069; pkinase | All Members of this Family | |
|---|---|---|---|
| Prosite (Info) | PS00107; PROTEIN_KINASE_ATP | Residues from 140: LGEGGFGSVFKGWVDENTFLPSRPGTGMVIAVKK All Members of this Family |
|
| PS00108; PROTEIN_KINASE_ST | Residues from 265: VIYRDFKTSNVLL All Members of this Family |
||
| PS50011; PROTEIN_KINASE_DOM | Sequence info. not available All Members of this Family |
||
| Physio-chemical features | Q94DF2 | ||
| ProtoMap (Info) | Q94DF2_ORYSA | ||
Database Cross-References (3) 
